Credentialing
Your NPI, state Medicaid enrollment, and a contract with each health plan in your area, which also lists you in their doula directories.
Tired of the business side? Let us handle it.
Credentialing, Medicaid and insurance billing, your website and business email. We take care of the business so you can focus on being a great doula and finding your next client.
Your claimsThis month
Labor and delivery supportMedicaid health plan
PaidPrenatal visit 3 of 4Medicaid health plan
SubmittedPostpartum visitDenied for a missing code
Fixed and resentCredentialingNew health plan contract
ApprovedExample: your claims, tracked in one place
Sound familiar?
You became a doula for the families, not the forms.
Evenings spent on Medicaid enrollment forms instead of resting between births.
Waiting months for a payment, with no idea why a claim was denied.
Calling a health plan and getting sent from one department to the next.
Paying separately for a scheduler, a website, an email and a billing tool.
Not knowing which health plans you can even bill in your state.
Wishing you could spend that time finding your next client.
We get it. That's why doulas are all we work with.
Doula billing is different
Most billing companies are built for doctors' offices.
Doula care has its own codes, visit limits and rules. Medicaid now pays doulas in 28 states and DC, each with its own program, and every health plan needs its own contract. We focus on doulas, so we know the codes, the forms and the plans in your state.
Not covered in your state yet? Some private insurance plans pay for doula care, and we can bill those too.
Where Medicaid pays doulas
AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFL
- Medicaid pays doulas (28 + DC)
- Starting soon (5)
- Not yet (17)
Source: National Academy for State Health Policy (NASHP), March 2026, updated with Arkansas and Utah Medicaid sources. Checked November 2026. Programs change, so check your state's Medicaid agency.
See every state
Medicaid pays doulas: Arizona, Arkansas, California, Colorado, Connecticut, Delaware, District of Columbia, Florida, Illinois, Kansas, Louisiana, Maryland, Massachusetts, Michigan, Minnesota, Missouri, Nevada, New Jersey, New Mexico, New York, Ohio, Oklahoma, Oregon, Pennsylvania, Rhode Island, South Dakota, Utah, Virginia, Washington.
Starting soon: Maine, Montana, New Hampshire, Tennessee, Vermont.
Not yet: Alabama, Alaska, Georgia, Hawaii, Idaho, Indiana, Iowa, Kentucky, Mississippi, Nebraska, North Carolina, North Dakota, South Carolina, Texas, West Virginia, Wisconsin, Wyoming.
The whole business side, handled
You do the doula work. We do everything around it.
Medicaid Private insurance Private pay
Billing and claims
Prenatal, labor and postpartum visits, coded right and sent on time.
Denials and follow-up
We fix and resend denied claims, and chase every payment until it lands.
Free practice app
Clients, visit notes, scheduling, contracts and invoices. Free while we do your billing.
Website, domain and email
We build your website, connect your own domain, and set up a matching business email and your Google Business profile. Free with the 12-month plan.
Online payments
Deposits, payment plans and HSA/FSA cards, with automatic reminders. Money goes straight to your bank account.
How we compare
A lower rate, and more included.
Other doula billing companies start as high as 12% and charge extra for setup. We never take more than 8%, and the 12-month plan includes everything else free.
| Doula Business HQ | Other doula billing companies | Doing it yourself | |
|---|---|---|---|
| Billing rate | Never more than 8% of what we collect | As high as 12% to start | No fee, but it costs your evenings |
| Onboarding or activation fee | $0 | Often charged per doula | – |
| Credentialing with Medicaid and each health plan | Free with the 12-month plan | Often an extra fee for each plan | Weeks of forms for each plan |
| Claims, denials and appeals | Handled for you | Handled for you | You chase every one |
| Practice app: clients, visit notes, scheduling, contracts | Free while we do your billing | Sometimes, with a monthly minimum | A separate subscription |
| Online payments: deposits, payment plans, HSA/FSA cards | Built into the free app | Usually a separate tool | Square, Stripe or PayPal on your own |
| Website, your own domain and business email | Setup free with the 12-month plan | Usually not offered | Several services to set up yourself |
| Monthly fee | $0 | Sometimes a monthly minimum | $0 |
| Contract | Your choice: 12 months or month-to-month | Some require a 1-year contract | – |
Comparison based on published pricing from doula-focused billing companies, November 2026. Their pricing may change.
How it works
Four steps. Then you just get to be a doula.
Free billing check
Fifteen minutes on the phone. Bring your NPI if you have one.
We enroll you
NPI, Medicaid, and every health plan your clients use.
You log visits
In the free app, built so every visit note is ready to bill.
We bill, you get paid
Plans pay you directly. We send the claims and track every payment.
Pricing
Never more than 8% of what we collect.
No monthly fee and no onboarding fee. If we don't collect, you don't pay. The practice app is free while you're a billing client.
Committed
- 12-month agreement
- Credentialing with every health plan, free
- Website, domain and business email setup, free
- Free practice app
Flexible
- Month-to-month, cancel anytime
- A set fee for each health plan we credential you with
- Free practice app
Questions
Frequently asked questions
What does Doula Business HQ do?
We handle the business side for doulas: Medicaid and insurance credentialing, billing, denials and appeals, plus a free practice app with online payments, and website, domain and business email setup.
Can my clients pay me through the app?
Yes. Private-pay clients can pay deposits and installments online by card, including HSA and FSA cards, and the app sends the reminders and receipts. Payments go straight to your bank account.
How much does it cost?
Never more than 8% of what we collect for you. There's no monthly fee and no onboarding fee, and if we don't collect, you don't pay.
Which states do you work with?
Doulas anywhere in the US. Medicaid pays doulas in 28 states and DC, and some private insurance plans cover doula care in other states.
Do I need an NPI before I start?
No. We set it up with you. An NPI is free and takes about 20 to 30 minutes.
I'm already enrolled in Medicaid. Can you take over my billing?
Yes. We start with your open and denied claims, then handle new claims going forward.
Do I have to sign a contract?
You choose. The 12-month plan includes free credentialing and website setup. The month-to-month plan has a set fee for each health plan we credential you with.
Free billing check
Take the business side off your plate.
Tell us where you practice. In 15 minutes, we'll tell you which plans you can bill and roughly what they pay.
Please don't include any client health information.
Rather talk now? Call us(518) 400-5817